Article No
ARP63610_P050-HRP
GHSR
GHSR Antibody - C-terminal region : HRP
Antibodies Primary
Specifications
| MW | 40kda |
| Accession Number | NM_198407, NP_940799 |
| Application | WB |
| Article No | ARP63610_P050-HRP |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | HRP |
| Description | GHSR Antibody - C-terminal region : HRP |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 1395,2693 |
| Gene Symbol | CRHR2, GHSR |
| Notes | This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature. |
| Previous Article No | ARP63610_P050-HRP-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, sheep/ovine |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | AAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWTESSIN |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, sheep/ovine |
| Storage | 4°C, -80°C |
| UniProt Number | B3SXS8 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
