Article No
ARP52054_P050-FITC
ENDOG
ENDOG Antibody - middle region : FITC
Antibodies Primary
Specifications
| MW | 28kDa |
| Accession Number | NM_004435, NP_004426 |
| Application | WB |
| Article No | ARP52054_P050-FITC |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | FITC |
| Description | ENDOG Antibody - middle region : FITC |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 2021 |
| Gene Symbol | ENDOG |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ENDOG |
| Notes | ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA. |
| Previous Article No | ARP52054_P050-FITC-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rat, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rat, fish |
| Storage | 4°C, -80°C |
| UniProt Number | Q14249 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
