Article No
ARP51766_P050
MW | 55kDa |
Accession Number | NM_020686, NP_065737 |
Application | WB |
Article No | ARP51766_P050 |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Description | ABAT antibody - middle region |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 18 |
Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Gene Symbol | ABAT |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ABAT |
Notes | 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. The protein sequence is over 95% similar to the pig protein. GABA is estimated to be present in nearly one-third of human synapses. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. |
Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, zebrafish |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW |
Shipping Information | BLUE ICE |
Size | 100 ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, fish |
Storage | -20°C, 4°C |
UniProt Number | P80404 |
Product Page Updated | 2024-03-06T13:52:09.583Z |