Article No
ARP43664_P050
Specifications
| MW | 174kDa |
| Accession Number | NM_005691, NP_005682 |
| Application | WB |
| Article No | ARP43664_P050 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Description | ABCC9 antibody - middle region |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 10060 |
| Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Gene Symbol | ABCC9 |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ABCC9 |
| Notes | ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. |
| Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK |
| Shipping Information | BLUE ICE |
| Size | 100 ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, fish |
| Storage | -20°C, 4°C |
| UniProt Number | O60706 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
