Article No
ARP40609_T100-HRP
SF3B4
SF3B4 Antibody - N-terminal region : HRP
Antibodies Primary
Specifications
| MW | 47kda |
| Accession Number | NM_005850, NP_005841 |
| Application | IHC, WB |
| Article No | ARP40609_T100-HRP |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | HRP |
| Description | SF3B4 Antibody - N-terminal region : HRP |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 10262 |
| Gene Symbol | SF3B4 |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B4 |
| Notes | SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA. |
| Previous Article No | ARP40609_T100-HRP-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Purified |
| Sequence | QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, fish |
| Storage | 4°C, -80°C |
| UniProt Number | Q15427 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
