Article No
ARP34358_P050
6720456H20Rik
6720456H20Rik Antibody - middle region
Antibodies Primary
Specifications
| MW | 63kDa |
| Accession Number | NM_172600, NP_766188 |
| Application | WB |
| Article No | ARP34358_P050 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Description | 6720456H20Rik Antibody - middle region |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 218989 |
| Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Gene Symbol | Tmem260 |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse 6720456H20Rik |
| Notes | The function of this protein remains unknown. |
| Predicted Species Reactivity | cow/bovine, dog/canine, horse/equine, human, mouse, pig/porcine, rabbit, rat, yeast |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | Synthetic peptide located within the following region: LFRLLKEKELTLSLLLRLTLAFSAGLLPYVYLPVSSYLSRARWTWGDQTT |
| Shipping Information | BLUE ICE |
| Size | 100 ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, horse/equine, human, mouse, pig/porcine, rabbit, rat, yeast |
| Storage | -20°C, 4°C |
| UniProt Number | Q8BMD6 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
