Antibodies Primary

RIPK4 Antibody

NEW
RIPK4 Antibody
This item can unfortunately not be purchased via our website. Please send an email to info@nordicbiosite.com, and we will handle your order directly.

Article No

OAAL00704

Application

WB, ELISA

Species Reactivity

human

Size

100 ug

Clone

3B1

Source / Host

mouse

Shipping Information

Wet Ice

Product insert

Suggested protocols

Specifications

Accession Number NP_065690
Additional Information The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq
Application WB, ELISA
Article No OAAL00704
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL
Clone 3B1
Clone Type monoclonal
Description RIPK4 Antibody
Supplier Aviva Systems Biology
Immunogen RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype IgG1 k
Keywords Monoclonal;
Notes The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq
Alias Names ANKK2, ANKRD3, DIK, MGC129992, MGC129993, PKK, RIP4
Product Type Antibodies Primary
Sequence Synthetic peptide located within the following region: HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Shipping Information Wet Ice
Size 100 ug
Source / Host mouse
Species Reactivity human
Storage Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Substrate / Buffer Liquid
Product Page Updated 2019-10-21T12:16:03.719Z

Shipping info

The delivery time for this item is approximately 8-16 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.