Antibodies Primary

HEY1 Antibody

NEW
HEY1 Antibody
This item can unfortunately not be purchased via our website. Please send an email to info@nordicbiosite.com, and we will handle your order directly.

Article No

OAAL00602

Application

WB, ELISA

Species Reactivity

human

Size

100 ug

Clone

1B9

Source / Host

mouse

Shipping Information

Wet Ice

Product insert

Suggested protocols

Specifications

Accession Number NP_036390
Additional Information This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Application WB, ELISA
Article No OAAL00602
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL
Clone 1B9
Clone Type monoclonal
Description HEY1 Antibody
Supplier Aviva Systems Biology
Immunogen HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype IgG2a k
Keywords Monoclonal;
Notes This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Alias Names BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1
Product Type Antibodies Primary
Sequence Synthetic peptide located within the following region: <a href='http://www.ncbi.nlm.nih.gov/blast/Blast.cgi?PROGRAM=blastp&CLIENT=web&SERVICE=plain&PAGE=Proteins&CMD=Put&DATABASE=nr&CDD_SEARCH=1&AUTO_FORMAT=Semi-auto&SHOW_OVERVIEW=on&SHOW_LINKOUT=on&GET_SEQUENCE=on&NCBI_GI=on&ALIGNMENTS=50&I_THRESH=0.005&QUERY=DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG' target='_blank'>DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG</a>
Shipping Information Wet Ice
Size 100 ug
Source / Host mouse
Species Reactivity human
Storage Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Substrate / Buffer Liquid
Product Page Updated 2019-10-21T12:16:03.719Z

Shipping info

The delivery time for this item is approximately 8-16 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.