Article No
OAAL00006-100UG
Accession Number | NP_065433 |
Application | FA |
Article No | OAAL00006-100UG |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone | 1D4 |
Clone Type | monoclonal |
Description | ADCY2 Antibody |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 108 |
Format | Liquid |
Gene Symbol | ADCY2 |
Immunogen | ADCY2 (NP_065433, 977 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Isotype | IgG2b k |
Notes | This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq |
Previous Article No | OAAL00006-100UG-100 |
Predicted Species Reactivity | human |
Product Type | Antibodies Primary |
Sequence | GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS |
Shipping Information | BLUE ICE |
Size | 100 ug |
Source / Host | mouse |
Species Reactivity | human, mouse |
Storage | -80°C |
Product Page Updated | 2024-03-06T13:52:09.583Z |