Article No
OAAL00006-100UG
Specifications
| Accession Number | NP_065433 |
| Application | FA |
| Article No | OAAL00006-100UG |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone | 1D4 |
| Clone Type | monoclonal |
| Description | ADCY2 Antibody |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 108 |
| Format | Liquid |
| Gene Symbol | ADCY2 |
| Immunogen | ADCY2 (NP_065433, 977 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Isotype | IgG2b k |
| Notes | This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq |
| Previous Article No | OAAL00006-100UG-100 |
| Predicted Species Reactivity | human |
| Product Type | Antibodies Primary |
| Sequence | GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS |
| Shipping Information | BLUE ICE |
| Size | 100 ug |
| Source / Host | mouse |
| Species Reactivity | human, mouse |
| Storage | -80°C |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
