Article No
LS-C756561-100
ACTN3
ACTN3 antibody LS-C756561 is a DY488-conjugated rabbit polyclonal antibody to human ACTN3. Validated for Flow.
Antibodies Primary
Specifications
| NCBI Number | 89 |
| Application | FC |
| Article No | LS-C756561-100 |
| Country Availability | SE, FI, DK, NO, FO, GL |
| Clone Type | polyclonal |
| Concentration | 1 mg/ml |
| Conjugation | DyLight 488 |
| Description | ACTN3 antibody LS-C756561 is a DY488-conjugated rabbit polyclonal antibody to human ACTN3. Validated for Flow. |
| Recommended Dilution | FC (1 - 3 ug/10e6 cells) |
| Supplier | LifeSpan Biosciences |
| Entrez Gene ID | 89 |
| Gene Symbol | ACTN3 |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-Terminus of human ACTN3 (574-617 aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids. |
| Isotype | IgG |
| Notes | ACTN3 antibody LS-C756561 is a DY488-conjugated rabbit polyclonal antibody to human ACTN3. Validated for Flow. |
| Alias Names | ACTN3, Actinin, alpha 3, Alpha-actinin skeletal muscle, Alpha-actinin-3, F-actin cross-linking protein |
| Product Type | Antibodies Primary |
| Protocol | Applications should be user optimized. |
| Purification | Affinity Purified |
| Shipping Information | RT |
| Size | 100 µg |
| Source / Host | rabbit |
| Species Reactivity | human |
| Storage | 4°C |
| Substrate / Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.02% Sodium Azide, 50% Glycerol |
| Technical Specifications | No cross reactivity with other proteins. |
| Product Page Updated | 2024-04-12T11:52:25.099Z |
