Article No
LS-C756560-100
NCBI Number | 89 |
Application | FC |
Article No | LS-C756560-100 |
Country Availability | SE, FI, DK, NO, FO, GL |
Clone Type | polyclonal |
Concentration | 1 mg/ml |
Conjugation | DyLight 550 |
Description | ACTN3 antibody LS-C756560 is a DY550-conjugated rabbit polyclonal antibody to human ACTN3. Validated for Flow. |
Recommended Dilution | FC (1 - 3 ug/10e6 cells) |
Supplier | LifeSpan Biosciences |
Entrez Gene ID | 89 |
Gene Symbol | ACTN3 |
Immunogen | A synthetic peptide corresponding to a sequence at the C-Terminus of human ACTN3 (574-617 aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids. |
Isotype | IgG |
Notes | ACTN3 antibody LS-C756560 is a DY550-conjugated rabbit polyclonal antibody to human ACTN3. Validated for Flow. |
Alias Names | ACTN3, Actinin, alpha 3, Alpha-actinin skeletal muscle, Alpha-actinin-3, F-actin cross-linking protein |
Product Type | Antibodies Primary |
Protocol | Applications should be user optimized. |
Purification | Affinity Purified |
Shipping Information | RT |
Size | 100 µg |
Source / Host | rabbit |
Species Reactivity | human |
Storage | 4°C |
Substrate / Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.02% Sodium Azide, 50% Glycerol |
Technical Specifications | No cross reactivity with other proteins. |
Product Page Updated | 2024-03-11T13:31:19.399Z |