Article No
LS-C756435-100
ABCC8 / SUR1
SUR1 antibody LS-C756435 is a DY488-conjugated rabbit polyclonal antibody to human SUR1 (ABCC8). Validated for Flow.
Antibodies Primary
Specifications
| NCBI Number | 6833 |
| Application | FC |
| Article No | LS-C756435-100 |
| Country Availability | SE, FI, DK, NO, FO, GL |
| Clone Type | polyclonal |
| Concentration | 1 mg/ml |
| Conjugation | DyLight 488 |
| Description | SUR1 antibody LS-C756435 is a DY488-conjugated rabbit polyclonal antibody to human SUR1 (ABCC8). Validated for Flow. |
| Recommended Dilution | FC (1 - 3 ug/10e6 cells) |
| Supplier | LifeSpan Biosciences |
| Entrez Gene ID | 6833 |
| Gene Symbol | ABCC8 |
| Immunogen | A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA). |
| Isotype | IgG |
| Notes | SUR1 antibody LS-C756435 is a DY488-conjugated rabbit polyclonal antibody to human SUR1 (ABCC8 ). Validated for Flow. |
| Alias Names | ABCC8, ABC36, HI, PHHI, Sulfonylurea receptor, SUR, Sulfonylurea receptor 1, MRP8, SUR1delta2, HHF1, HRINS, SUR1, TNDM2 |
| Product Type | Antibodies Primary |
| Protocol | Applications should be user optimized. |
| Purification | Affinity Purified |
| Shipping Information | RT |
| Size | 100 µg |
| Source / Host | rabbit |
| Species Reactivity | human |
| Storage | 4°C |
| Substrate / Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.02% Sodium Azide, 50% Glycerol |
| Technical Specifications | No cross reactivity with other proteins. |
| Product Page Updated | 2024-04-12T11:52:25.099Z |
