Article No
LS-C229238-100
NCBI Number | 6310 |
Application | IHC, IP, WB |
Article No | LS-C229238-100 |
Country Availability | SE, FI, DK, NO, FO, GL |
Clone | S76-8 |
Clone Type | monoclonal |
Concentration | 1 mg/ml |
Conjugation | PerCP |
Description | SCA1 antibody LS-C229238 is a PerCP-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB. |
Supplier | LifeSpan Biosciences |
Entrez Gene ID | 6310 |
Gene Symbol | ATXN1 |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%). |
Isotype | IgG2b |
Notes | SCA1 antibody LS-C229238 is a PerCP-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB. |
Alias Names | ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1 |
Product Type | Antibodies Primary |
Protocol | The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. |
Purification | Protein G Purified |
Shipping Information | RT |
Size | 100 µg |
Source / Host | mouse |
Species Reactivity | human, mouse, rat |
Storage | -20°C |
Substrate / Buffer | PBS, pH 7.4, 0.1% Sodium Azide, 50% Glycerol |
Technical Specifications | Detects a 85 kD protein. |
Product Page Updated | 2024-04-12T06:35:05.844Z |