Article No
LS-C229238-100
ATXN1 / SCA1
SCA1 antibody LS-C229238 is a PerCP-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
Antibodies Primary
Specifications
| NCBI Number | 6310 |
| Application | IHC, IP, WB |
| Article No | LS-C229238-100 |
| Country Availability | SE, FI, DK, NO, FO, GL |
| Clone | S76-8 |
| Clone Type | monoclonal |
| Concentration | 1 mg/ml |
| Conjugation | PerCP |
| Description | SCA1 antibody LS-C229238 is a PerCP-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB. |
| Supplier | LifeSpan Biosciences |
| Entrez Gene ID | 6310 |
| Gene Symbol | ATXN1 |
| Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%). |
| Isotype | IgG2b |
| Notes | SCA1 antibody LS-C229238 is a PerCP-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB. |
| Alias Names | ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1 |
| Product Type | Antibodies Primary |
| Protocol | The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. |
| Purification | Protein G Purified |
| Shipping Information | RT |
| Size | 100 µg |
| Source / Host | mouse |
| Species Reactivity | human, mouse, rat |
| Storage | -20°C |
| Substrate / Buffer | PBS, pH 7.4, 0.1% Sodium Azide, 50% Glycerol |
| Technical Specifications | Detects a 85 kD protein. |
| Product Page Updated | 2024-04-12T06:35:05.844Z |
