Article No
GTX13248
Heme Oxygenase 1
Heme Oxygenase 1 antibody [HO-1-1]
Antibodies Primary
Specifications
| Application | FC, ICC, IF, IHC, WB |
| Article No | GTX13248 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT |
| Clone | HO-1-1 |
| Clone Type | monoclonal |
| Concentration | 1 mg/ml |
| Conjugation | Unconjugated |
| Control Tissue | Recombinant Human or Rat HO-1 (Hsp32) Protein |
| Description | Heme Oxygenase 1 antibody [HO-1-1] |
| Supplier | GeneTex |
| Entrez Gene ID | 3162 |
| Gene Symbol | HMOX1 |
| Immunogen | Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1. |
| Isotype | IgG1 |
| Notes | Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008] |
| Product Type | Antibodies Primary |
| Protocol | For FACS: Use at a concentration of 10 µg/ml. Foe WB: Use at a concentration of 4 µg/ml. Detects a band of approximately 32 kDa. Optimal dilutions/concentrations should be determined by the end user. |
| Purification | Protein G Purified |
| Size | 50µg |
| Source / Host | mouse |
| Species Reactivity | cow/bovine, dog/canine, human, mouse, rat |
| Storage | 4°C, -80°C |
| UniProt Number | P09601 |
| Product Page Updated | 2024-01-03T10:31:47.950Z |
