AK

Article No CSB-EP511311ETF-50
Product Type Proteins & Peptides
Research Area Inflammation
Size 50ug

This product is not available for sale in your country. Please feel free to contact the help desk if you have any questions.

Specifications

MW 56 kDa
Additional Information Full Length of Mature Protein
Country Availability SE, FI, DK, NO, IS, EE, LV, LT
Description Recombinant Penaeus monodon Arginine kinase(AK)
Supplier Cusabio - Wuhan Huamei Biotech Co, Ltd
Alias Names Allergen: Pen m 2
Purity Greater than 90% as determined by SDS-PAGE.
References "Proteomics and immunological analysis of a novel shrimp allergen, Pen m 2."Yu C.J., Lin Y.F., Chiang B.L., Chow L.P.J. Immunol. 170:445-453(2003)
Sequence ADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM
Size 50
Source / Host bacteria
Species Reactivity other marine species
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Substrate / Buffer Tris-based buffer,50% glycerol
Technical Specifications N-terminal 6xHis-SUMO-tagged

Shipping info

The delivery time for this item is approximately 5-8 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.

Source/Host:

bacteria

Species reactivity:

other marine species