
AK
This product is not available for sale in your country. Please feel free to contact the help desk if you have any questions.
Specifications
MW | 56 kDa |
Additional Information | Full Length of Mature Protein |
Country Availability | DK, EE, FI, FO, GL, IS, LT, LV, NO, SE |
Description | Recombinant Penaeus monodon Arginine kinase(AK) |
Supplier | Cusabio - Wuhan Huamei Biotech Co, Ltd |
Alias Names | Allergen: Pen m 2 |
Purity | Greater than 90% as determined by SDS-PAGE. |
References | "Proteomics and immunological analysis of a novel shrimp allergen, Pen m 2."Yu C.J., Lin Y.F., Chiang B.L., Chow L.P.J. Immunol. 170:445-453(2003) |
Sequence | ADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM |
Size | 1 |
Source / Host | bacteria |
Species Reactivity | other marine species |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Substrate / Buffer | Tris-based buffer,50% glycerol |
Technical Specifications | N-terminal 6xHis-SUMO-tagged |
Product Page Updated | 2018-10-09T09:57:50.668Z |
Shipping info
The delivery time for this item is approximately 7-10 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.