Proteins & Peptides

AK

NEW
Recombinant Penaeus monodon Arginine kinase(AK)

Article No

CSB-EP511311ETF-1

Species Reactivity

other marine species

Size

1mg

Source / Host

bacteria

Product insert

Specifications

MW 56 kDa
Additional Information Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Article No CSB-EP511311ETF-1
Description Recombinant Penaeus monodon Arginine kinase(AK)
Supplier Cusabio - Wuhan Huamei Biotech Co, Ltd
Alias Names Allergen: Pen m 2
Product Type Proteins & Peptides
Purification Greater than 90% as determined by SDS-PAGE.
References "Proteomics and immunological analysis of a novel shrimp allergen, Pen m 2."Yu C.J., Lin Y.F., Chiang B.L., Chow L.P.J. Immunol. 170:445-453(2003)
Sequence ADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM
Size 1mg
Source / Host bacteria
Species Reactivity other marine species
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Substrate / Buffer Tris-based buffer,50% glycerol
UniProt Number C7E3T4
Product Page Updated 2019-05-13T08:38:37.388Z

Shipping info

The delivery time for this item is approximately 7-10 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.