Article No
ARP65819_P050-Biotin
PTPN21
PTPN21 Antibody - C-terminal region : Biotin
Antibodies Primary
Specifications
| MW | 133kDa |
| Accession Number | NM_007039, NP_008970 |
| Application | WB |
| Article No | ARP65819_P050-Biotin |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | Biotin |
| Description | PTPN21 Antibody - C-terminal region : Biotin |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 11099 |
| Gene Symbol | PTPN21 |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTPN21 |
| Notes | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal domain, similar to cytoskeletal- associated proteins including band 4.1, ezrin, merlin, and radixin. This PTP was shown to specially interact with BMX/ETK, a member of Tec tyrosine kinase family characterized by a multimodular structures including PH, SH3, and SH2 domains. The interaction of this PTP with BMX kinase was found to increase the activation of STAT3, but not STAT2 kinase. Studies of the similar gene in mice suggested the possible roles of this PTP in liver regeneration and spermatogenesis. |
| Previous Article No | ARP65819_P050-Biotin-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | FWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTYGRFKITT |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, fish |
| Storage | 4°C, -80°C |
| UniProt Number | Q16825 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
