Article No
ARP65780_P050-HRP
LIMS2
LIMS2 Antibody - N-terminal region : HRP
Antibodies Primary
Specifications
| MW | 38kda |
| Accession Number | NM_001161404, NP_001154876 |
| Application | WB |
| Article No | ARP65780_P050-HRP |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | HRP |
| Description | LIMS2 Antibody - N-terminal region : HRP |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 55679 |
| Gene Symbol | LIMS2 |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIMS2 |
| Notes | This gene encodes a member of a small family of focal adhesion proteins which interacts with ILK (integrin-linked kinase), a protein which effects protein-protein interactions with the extraceullar matrix. The encoded protein has five LIM domains, each domain forming two zinc fingers, which permit interactions which regulate cell shape and migration. A pseudogene of this gene is located on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Previous Article No | ARP65780_P050-HRP-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | DVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFR |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, fish |
| Storage | 4°C, -80°C |
| UniProt Number | Q7Z4I7 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
