Antibodies Primary

CYP24A1 Antibody - C-terminal region

CYP24A1 Antibody - C-terminal region
This item can unfortunately not be purchased via our website. Please send an email to, and we will handle your order directly.

Article No




Species Reactivity

guinea pig


100 ul

Source / Host


Shipping Information

Wet Ice

Product insert

Suggested protocols


MW 55kDa
Accession Number NM_000782
Additional Information This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Application WB, IHC
Article No ARP60146_P050
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL
Clone Type polyclonal
Description CYP24A1 Antibody - C-terminal region
Supplier Aviva Systems Biology
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CYP24A1
Keywords Polyclonal; Drugs and Drug Metabolism; Mitochondria; Disease Related;
Notes This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Alias Names CP24, CYP24, MGC126273, MGC126274, P450-CC24, HCAI
Product Type Antibodies Primary
Purification Affinity Purified
Sequence Synthetic peptide located within the following region: <a href='' target='_blank'>QVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAE</a>
Shipping Information Wet Ice
Size 100 ul
Source / Host rabbit
Species Reactivity dog/canine, guinea pig, human, mouse, rabbit, rat
Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Substrate / Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Technical Specifications <b style='color:#DC6809'>Click <a href='//' target='_blank'>here</a> to learn more about Aviva's By-Request Conjugation Service.</b>
Product Page Updated 2019-10-21T12:16:03.719Z

Shipping info

The delivery time for this item is approximately 8-16 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.