Article No
ARP59897_P050
Specifications
| MW | 42kda |
| Accession Number | NM_052838, NP_443070 |
| Application | WB |
| Article No | ARP59897_P050 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Description | SEPT1 Antibody - N-terminal region |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 1731,45536 |
| Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Gene Symbol | l(2)44Fb, SEPTIN1 |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT1 |
| Notes | This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | Synthetic peptide located within the following region: FGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFIS |
| Shipping Information | BLUE ICE |
| Size | 100 ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, fish |
| Storage | -20°C, 4°C |
| UniProt Number | Q8WYJ6 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
