Article No
ARP56660_P050-HRP
SEPT2
SEPT2 Antibody - N-terminal region : HRP
Antibodies Primary
Specifications
| MW | 41kda |
| Accession Number | NM_006155, NP_006146 |
| Application | WB |
| Article No | ARP56660_P050-HRP |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | HRP |
| Description | SEPT2 Antibody - N-terminal region : HRP |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 4735 |
| Gene Symbol | SEPTIN2 |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT2 |
| Notes | SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis. |
| Previous Article No | ARP56660_P050-HRP-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, fish |
| Storage | 4°C, -80°C |
| UniProt Number | Q15019 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
