Article No
ARP54991_P050
MW | 19kDa |
Accession Number | NM_173752, NP_776113 |
Application | WB |
Article No | ARP54991_P050 |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Description | 1110067D22Rik antibody - middle region |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 216551 |
Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Gene Symbol | Lgalsl |
Notes | 1110067D22Rik does not bind lactose, and may not bind carbohydrates. |
Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | Synthetic peptide located within the following region: CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ |
Shipping Information | BLUE ICE |
Size | 100 ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
Storage | -20°C, 4°C |
UniProt Number | Q8VED9 |
Product Page Updated | 2024-03-06T13:52:09.583Z |