Article No
ARP54991_P050
1110067D22Rik
1110067D22Rik antibody - middle region
Antibodies Primary
Specifications
| MW | 19kDa |
| Accession Number | NM_173752, NP_776113 |
| Application | WB |
| Article No | ARP54991_P050 |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Description | 1110067D22Rik antibody - middle region |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 216551 |
| Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Gene Symbol | Lgalsl |
| Notes | 1110067D22Rik does not bind lactose, and may not bind carbohydrates. |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | Synthetic peptide located within the following region: CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ |
| Shipping Information | BLUE ICE |
| Size | 100 ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat |
| Storage | -20°C, 4°C |
| UniProt Number | Q8VED9 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
