Article No
ARP54536_P050-HRP
MW | 28kDa |
Accession Number | NM_025762, NP_080038 |
Application | WB |
Article No | ARP54536_P050-HRP |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | HRP |
Description | 4933434E20Rik Antibody - N-terminal region : HRP |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 99650 |
Gene Symbol | 4933434E20Rik |
Notes | The function of this protein remains unknown. |
Previous Article No | ARP54536_P050-HRP-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, zebrafish |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | FIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQ |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, fish |
Storage | 4°C, -80°C |
UniProt Number | Q8R092 |
Product Page Updated | 2024-03-06T13:52:09.583Z |