Article No
ARP54306_P050-FITC
MW | 125kDa |
Accession Number | NM_000215, NP_000206 |
Application | WB |
Article No | ARP54306_P050-FITC |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | FITC |
Description | JAK3 Antibody - middle region : FITC |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 3718 |
Gene Symbol | JAK3 |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human JAK3 |
Notes | JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).The protein encoded by this gene is a member of the Janus kinase (JAK) family of tyrosine kinases involved in cytokine receptor-mediated intracellular signal transduction. It is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in this gene are associated with autosomal SCID (severe combined immunodeficiency disease). Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Previous Article No | ARP54306_P050-FITC-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, horse/equine, human, mouse, pig/porcine, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, horse/equine, human, mouse, pig/porcine, rat |
Storage | 4°C, -80°C |
UniProt Number | P52333 |
Product Page Updated | 2024-03-06T13:52:09.583Z |