Article No
ARP52697_P050-FITC
SEPT12
SEPT12 Antibody - middle region : FITC
Antibodies Primary
Specifications
| MW | 41kda |
| Accession Number | NM_144605, NP_653206 |
| Application | WB |
| Article No | ARP52697_P050-FITC |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | FITC |
| Description | SEPT12 Antibody - middle region : FITC |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 124404 |
| Gene Symbol | SEPTIN12 |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SEPT12 |
| Notes | Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia.Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia (Hall et al., 2005 [PubMed 15915442]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1290 AK058139.1 2-1291 |
| Previous Article No | ARP52697_P050-FITC-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, zebrafish |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, fish |
| Storage | 4°C, -80°C |
| UniProt Number | Q8IYM1 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
