Article No
ARP51766_P050-HRP
MW | 55kDa |
Accession Number | NM_020686, NP_065737 |
Application | WB |
Article No | ARP51766_P050-HRP |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | HRP |
Description | ABAT Antibody - middle region : HRP |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 18 |
Gene Symbol | ABAT |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ABAT |
Notes | 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. The protein sequence is over 95% similar to the pig protein. GABA is estimated to be present in nearly one-third of human synapses. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. |
Previous Article No | ARP51766_P050-HRP-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, zebrafish |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, fish |
Storage | 4°C, -80°C |
UniProt Number | P80404 |
Product Page Updated | 2024-03-06T13:52:09.583Z |