Article No
ARP44642_P050-HRP
MW | 34kda |
Accession Number | NM_001012755, NP_001012773 |
Application | WB |
Article No | ARP44642_P050-HRP |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | HRP |
Description | MCART6 Antibody - middle region : HRP |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 401612 |
Gene Symbol | SLC25A53 |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MCART6 |
Notes | The function of this protein remains unknown. |
Previous Article No | ARP44642_P050-HRP-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat |
Storage | 4°C, -80°C |
UniProt Number | Q5H9E4 |
Product Page Updated | 2024-03-06T13:52:09.583Z |