Article No
ARP43535_P050
MW | 47kda |
Accession Number | NM_016228, NP_057312 |
Application | WB |
Article No | ARP43535_P050 |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Description | AADAT antibody - middle region |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 51166 |
Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Gene Symbol | AADAT |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AADAT |
Notes | AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathw |
Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, zebrafish |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | Synthetic peptide located within the following region: EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI |
Shipping Information | BLUE ICE |
Size | 100 ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast, fish |
Storage | -20°C, 4°C |
UniProt Number | Q8N5Z0 |
Product Page Updated | 2024-03-06T13:52:09.583Z |