Article No
ARP42739_P050-FITC
SIGLEC6
SIGLEC6 Antibody - middle region : FITC
Antibodies Primary
Specifications
| MW | 36kda |
| Accession Number | NM_198846, NP_942143 |
| Application | WB |
| Article No | ARP42739_P050-FITC |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | FITC |
| Description | SIGLEC6 Antibody - middle region : FITC |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 946 |
| Gene Symbol | SIGLEC6 |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SIGLEC6 |
| Notes | SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. |
| Previous Article No | ARP42739_P050-FITC-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat |
| Storage | 4°C, -80°C |
| UniProt Number | O43699-4 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
