Article No
ARP41896_P050
MW | 9kDa |
Accession Number | NM_001040649.2, NP_001035739.1 |
Application | WB |
Article No | ARP41896_P050 |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Description | ACP1 Antibody - N-terminal region |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 52 |
Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Gene Symbol | ACP1 |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human ACP1 |
Notes | The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, rabbit, rat |
Product Type | Antibodies Primary |
Purification | Affinity Purified |
Sequence | Synthetic peptide located within the following region: VCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAV |
Shipping Information | BLUE ICE |
Size | 100 ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, rabbit, rat |
Storage | -20°C, 4°C |
UniProt Number | P24666 |
Product Page Updated | 2024-03-06T13:52:09.583Z |