Article No
ARP41731_P050-HRP
KRT19
KRT19 Antibody - middle region : HRP
Antibodies Primary
Specifications
| MW | 44kda |
| Accession Number | NM_002276, NP_002267 |
| Application | WB |
| Article No | ARP41731_P050-HRP |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | HRP |
| Description | KRT19 Antibody - middle region : HRP |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 3880 |
| Gene Symbol | KRT19 |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human KRT19 |
| Notes | KRT19 involved in the organization of myofibers. Together with KRT8, KRT19 helps to link the contractile apparatus to dystrophin at the costameres of striated muscle. |
| Previous Article No | ARP41731_P050-HRP-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, sheep/ovine |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, goat, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, sheep/ovine |
| Storage | 4°C, -80°C |
| UniProt Number | P08727 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
