Article No
ARP40627_T100-Biotin
PPIE
PPIE Antibody - middle region : Biotin
Antibodies Primary
Specifications
| MW | 33kDa |
| Accession Number | NM_006112, NP_006103 |
| Application | IHC, WB |
| Article No | ARP40627_T100-Biotin |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | Biotin |
| Description | PPIE Antibody - middle region : Biotin |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 10450 |
| Gene Symbol | PPIE |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PPIE |
| Notes | PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Previous Article No | ARP40627_T100-Biotin-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, sheep/ovine, yeast |
| Product Type | Antibodies Primary |
| Purification | Purified |
| Sequence | KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, pig/porcine, rabbit, rat, sheep/ovine, yeast |
| Storage | 4°C, -80°C |
| UniProt Number | Q9UNP9 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
