Article No
ARP35908_T100-FITC
MW | 66kDa |
Accession Number | NM_016213, NP_057297 |
Application | WB |
Article No | ARP35908_T100-FITC |
Availability | In Stock |
Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
Clone Type | polyclonal |
Concentration | 0.5 mg/ml |
Conjugation | FITC |
Description | TRIP4 Antibody - middle region : FITC |
Supplier | Aviva Systems Biology |
Entrez Gene ID | 9325 |
Gene Symbol | TRIP4 |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRIP4 |
Notes | TRIP4 is a transcription coactivator of nuclear receptors which functions in conjunction with CBP-p300 and SRC-1 and may play an important role in establishing distinct coactivator complexes under different cellular conditions. TRIP4 plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. TRIP4 acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. It plays a role in androgen receptor transactivation and in testicular function |
Previous Article No | ARP35908_T100-FITC-100 |
Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, zebrafish |
Product Type | Antibodies Primary |
Purification | Purified |
Sequence | VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV |
Shipping Information | BLUE ICE |
Size | 100ul |
Source / Host | rabbit |
Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, fish |
Storage | 4°C, -80°C |
UniProt Number | Q15650 |
Product Page Updated | 2024-03-06T13:52:09.583Z |