Article No
ARP33951_P050-FITC
KIFC2
KIFC2 Antibody - N-terminal region : FITC
Antibodies Primary
Specifications
| MW | 90kDa |
| Accession Number | NM_145754, NP_665697 |
| Application | WB |
| Article No | ARP33951_P050-FITC |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | FITC |
| Description | KIFC2 Antibody - N-terminal region : FITC |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 90990 |
| Gene Symbol | KIFC2 |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KIFC2 |
| Notes | Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division. |
| Previous Article No | ARP33951_P050-FITC-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rat, yeast |
| Product Type | Antibodies Primary |
| Purification | Affinity Purified |
| Sequence | TQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGA |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rat, yeast |
| Storage | 4°C, -80°C |
| UniProt Number | Q96AC6 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
