Article No
ARP31263_T100-Biotin
NFYA
NFYA Antibody - C-terminal region : Biotin
Antibodies Primary
Specifications
| MW | 37kDa |
| Accession Number | NM_002505, NP_002496 |
| Application | IHC, WB |
| Article No | ARP31263_T100-Biotin |
| Availability | In Stock |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Clone Type | polyclonal |
| Concentration | 0.5 mg/ml |
| Conjugation | Biotin |
| Description | NFYA Antibody - C-terminal region : Biotin |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 4800 |
| Gene Symbol | NFYA |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NFYA |
| Notes | NFYA is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. |
| Previous Article No | ARP31263_T100-Biotin-100 |
| Predicted Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast |
| Product Type | Antibodies Primary |
| Purification | Purified |
| Sequence | YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
| Shipping Information | BLUE ICE |
| Size | 100ul |
| Source / Host | rabbit |
| Species Reactivity | cow/bovine, dog/canine, guinea pig, horse/equine, human, mouse, rabbit, rat, yeast |
| Storage | 4°C, -80°C |
| UniProt Number | P23511 |
| Product Page Updated | 2024-03-06T13:52:09.583Z |
