14-3-3 Gamma

Article No ACC-600232
Product Type Proteins & Peptides
Research Area Cell Proliferation
Application ELISA, WB
Size 0.01 mg

This product is not available for sale in your country. Please feel free to contact the help desk if you have any questions.

Specifications

MW 32.67 kDa
Additional Information E. coli
Country Availability SE, FI, DK, NO, IS, EE, LV, LT
Description Human 14-3-3 Gamma
Supplier Abbiotec LLC
Notes 14-3-3-Gamma is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. 14-3-3-Gamma binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Recombinant 14-3-3 gamma comprises a 246 amino acid fragment (2-247) corresponding to the 14-3-3 gamma coding sequence and is expressed in E. coli with an amino-terminal hexahistidine tag.
Alias Names 14-3-3-Gamma; Protein kinase C inhibitor protein 1; KCIP-1
Purity Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Sequence His-Tag sequence not included: VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
Source / Host bacteria
Storage Store at -20°C. Product is guaranteed one year from the date of shipment.
Substrate / Buffer Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Product Page Updated 2018-05-09T14:42:33.496Z

Shipping info

The delivery time for this item is approximately 5-8 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.

Source/Host:

bacteria

Suggested protocols:

Western Blot

Western Blot