1110021J02Rik Peptide - middle region

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufacturers this antibody so we can offer the best price. Please contact us to request pricing information. All of Aviva's products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this produce will work for you? Please contact us at techsupport@avivasysbio.com

Proteins & Peptides

Article No

AAP68048-100

Application

WB

Size

100ug

Shipping Information

Room Temperature

Article No

AAP68048-100

Application

WB

Size

100ug

Shipping Information

Room Temperature

Specifications

MW 11kDa
Accession Number NM_001163741, NP_001157213
Additional Information The function of this protein remains unknown.
Application WB
Article No AAP68048-100
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL, RU
Description To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufacturers this antibody so we can offer the best price. Please contact us to request pricing information. All of Aviva's products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this produce will work for you? Please contact us at techsupport@avivasysbio.com
Supplier Aviva Systems Biology
Entrez Gene ID 68597
Format Lyophilized powder
Gene Symbol Ccdc167
Keywords Peptide
Notes This is a synthetic peptide designed for use in combination with anti-1110021J02Rik Antibody (ARP68048_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Alias Names Ccdc167, 1110021J02Rik
Predicted Species Reactivity human, mouse
Product Type Proteins & Peptides
Sequence Synthetic peptide located within the following region: MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLE
Shipping Information Room Temperature
Size 100ug
Storage -20°C
Substrate / Buffer Lyophilized powder
Technical Specifications The function of this protein remains unknown.
UniProt Number Q9D162
Product Page Updated 2022-09-15T12:55:11.302Z

Documentation

Suggested protocols

Shipping info
The delivery time for this item is approximately 8-16 business days. Read more