Article No
AAP55633-100UG
1190002N15Rik Peptide - N-terminal region
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufacturers this antibody so we can offer the best price. Please contact us to request pricing information. All of Aviva's products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this produce will work for you? Please contact us at techsupport@avivasysbio.com
Proteins & Peptides
Specifications
| MW | 49kDa |
| Accession Number | NP_001028317 |
| Application | WB |
| Article No | AAP55633-100UG |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Description | To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufacturers this antibody so we can offer the best price. Please contact us to request pricing information. All of Aviva's products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this produce will work for you? Please contact us at techsupport@avivasysbio.com |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 68861 |
| Format | Lyophilized powder |
| Gene Symbol | Dipk2a |
| Notes | This is a synthetic peptide designed for use in combination with anti-1190002N15Rik Antibody (ARP55633_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Previous Article No | AAP55633-100UG-100 |
| Predicted Species Reactivity | human, mouse |
| Product Type | Proteins & Peptides |
| Sequence | FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR |
| Size | 100ug |
| UniProt Number | Q3USZ8 |
| Product Page Updated | 2023-02-21T08:45:07.603Z |
