1110067D22Rik Peptide - middle region

This is a synthetic peptide designed for use in combination with anti-1110067D22Rik Antibody (ARP54991_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.

Proteins & Peptides

Article No

AAP54991-100

Application

WB

Size

100ug

Shipping Information

Room Temperature

Article No

AAP54991-100

Application

WB

Size

100ug

Shipping Information

Room Temperature

Specifications

MW 19kDa
Accession Number NM_173752, NP_776113
Additional Information 1110067D22Rik does not bind lactose, and may not bind carbohydrates.
Application WB
Article No AAP54991-100
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL, RU
Description This is a synthetic peptide designed for use in combination with anti-1110067D22Rik Antibody (ARP54991_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Supplier Aviva Systems Biology
Entrez Gene ID 216551
Format Lyophilized powder
Gene Symbol Lgalsl
Keywords Peptide
Notes This is a synthetic peptide designed for use in combination with anti-1110067D22Rik Antibody (ARP54991_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Alias Names Grpa, Hspc159, Lgalsla, A530071M23, RP23-455B19.1, 1110067D22Rik
Predicted Species Reactivity mouse
Product Type Proteins & Peptides
Sequence CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ
Shipping Information Room Temperature
Size 100ug
Storage -20°C
Substrate / Buffer Lyophilized powder
Technical Specifications 1110067D22Rik does not bind lactose, and may not bind carbohydrates.
UniProt Number Q8VED9
Product Page Updated 2022-09-15T12:55:11.302Z

Documentation

Suggested protocols

Shipping info
The delivery time for this item is approximately 8-16 business days. Read more