0910001L09Rik Peptide - N-terminal region

This is a synthetic peptide designed for use in combination with anti-0910001L09Rik Antibody (ARP54397_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.

Proteins & Peptides

Article No

AAP54397-100

Application

WB

Size

100ug

Shipping Information

Room Temperature

Article No

AAP54397-100

Application

WB

Size

100ug

Shipping Information

Room Temperature

Specifications

MW 11kDa
Accession Number NM_001081108, NP_001074577
Additional Information The function of this protein remains unknown.
Application WB
Article No AAP54397-100
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL, RU
Description This is a synthetic peptide designed for use in combination with anti-0910001L09Rik Antibody (ARP54397_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Supplier Aviva Systems Biology
Entrez Gene ID 66096
Format Lyophilized powder
Gene Symbol Lamtor4
Keywords Peptide
Notes This is a synthetic peptide designed for use in combination with anti-0910001L09Rik Antibody (ARP54397_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Alias Names AV006840, 0910001L09Rik
Predicted Species Reactivity human, mouse
Product Type Proteins & Peptides
Sequence MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA
Shipping Information Room Temperature
Size 100ug
Storage -20°C
Substrate / Buffer Lyophilized powder
Technical Specifications The function of this protein remains unknown.
UniProt Number Q8CF66
Product Page Updated 2022-09-15T12:55:11.302Z

Documentation

Suggested protocols

Shipping info
The delivery time for this item is approximately 8-16 business days. Read more