Article No
AAP53424-100UG
1110059E24Rik Peptide - N-terminal region
This is a synthetic peptide designed for use in combination with anti-1110059E24Rik Antibody (ARP53424_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Proteins & Peptides
Specifications
| MW | 18kDa |
| Accession Number | NP_079699 |
| Application | WB |
| Article No | AAP53424-100UG |
| Country Availability | SE, FI, DK, NO, IS, EE, LV, LT, FO, GL |
| Description | This is a synthetic peptide designed for use in combination with anti-1110059E24Rik Antibody (ARP53424_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Supplier | Aviva Systems Biology |
| Entrez Gene ID | 66206 |
| Format | Lyophilized powder |
| Gene Symbol | 1110059E24Rik |
| Notes | This is a synthetic peptide designed for use in combination with anti-1110059E24Rik Antibody (ARP53424_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Previous Article No | AAP53424-100UG-100 |
| Predicted Species Reactivity | human, mouse |
| Product Type | Proteins & Peptides |
| Sequence | TFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKC |
| Size | 100ug |
| UniProt Number | Q9CQ90 |
| Product Page Updated | 2023-02-21T08:45:07.603Z |
