1110059E24Rik

Article No AAP53423
Product Type Proteins & Peptides
Application WB
Size 100ug

This product is not available for sale in your country. Please feel free to contact the help desk if you have any questions.

Specifications

MW 18kDa
Accession Number NM_025423
Additional Information The function of this protein remains unknown.
Country Availability DK, EE, FI, FO, GL, IS, LT, LV, NO, SE
Data Sheet Link http://www.avivasysbio.com/sd/tds/html_datasheet.php?sku=AAP00000
Description 1110059E24Rik Peptide - N-terminal region (AAP53423)
Supplier Aviva Systems Biology
Keywords Peptide
Notes The function of this protein remains unknown.
Alias Names -
Sequence KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRP
Species Reactivity mouse, human
Storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Substrate / Buffer Lyophilized powder
Product Page Updated 2019-01-11T14:50:38.678Z

Shipping info

The delivery time for this item is approximately 8-12 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.

Species reactivity:

mouse, human mouse human

Product insert:

Product data sheet

Datasheet

Suggested protocols:

Western Blot

Western Blot