Proteins & Peptides

1110059E24Rik

NEW
1110059E24Rik Peptide - N-terminal region (AAP53423)

Article No

AAP53423

Application

WB

Species Reactivity

mouse
human

Size

100ug

Shipping Information

Room Temperature

Product insert

Suggested protocols

Specifications

MW 18kDa
Accession Number NM_025423
Additional Information The function of this protein remains unknown.
Application WB
Article No AAP53423
Description 1110059E24Rik Peptide - N-terminal region (AAP53423)
Supplier Aviva Systems Biology
Keywords Peptide
Notes The function of this protein remains unknown.
Alias Names -
Product Type Proteins & Peptides
Sequence KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRP
Shipping Information Room Temperature
Size 100ug
Species Reactivity mouse, human
Storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Substrate / Buffer Lyophilized powder
Product Page Updated 2019-01-11T14:50:38.678Z

Shipping info

The delivery time for this item is approximately 8-16 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.