Proteins & Peptides

1110059E24Rik Peptide - N-terminal region

This is a synthetic peptide designed for use in combination with anti-1110059E24Rik Antibody (ARP53423_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.

Article No

AAP53423-100

Application

WB

Size

100ug

Shipping Information

Room Temperature

Documentation

Suggested protocols

Specifications

MW 18kDa
Accession Number NM_025423, NP_079699
Additional Information The function of this protein remains unknown.
Application WB
Article No AAP53423-100
Country Availability SE, FI, DK, NO, IS, EE, LV, LT, FO, GL, RU
Description This is a synthetic peptide designed for use in combination with anti-1110059E24Rik Antibody (ARP53423_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Supplier Aviva Systems Biology
Entrez Gene ID 66206
Format Lyophilized powder
Gene Symbol 1110059E24Rik
Keywords Peptide
Notes This is a synthetic peptide designed for use in combination with anti-1110059E24Rik Antibody (ARP53423_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Alias Names -
Predicted Species Reactivity human, mouse
Product Type Proteins & Peptides
Sequence KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRP
Shipping Information Room Temperature
Size 100ug
Storage -20°C
Substrate / Buffer Lyophilized powder
Technical Specifications The function of this protein remains unknown.
UniProt Number Q9CQ90
Product Page Updated 2022-09-15T12:55:11.302Z

Shipping info

The delivery time for this item is approximately 8-16 business days. If other deviations occur, this will be noted on the order confirmation or communicated via email. Please note, we do reserve the right to select the best packaging and shipping method in order to insure the stability of the product and allow efficient order tracking.